Upload Avatar (500 x 500)
Bo Zhao
Life Science
University of Chinese Academy of Sciences
Yunnan
Language: Chinese, English
Genomic Stability
Dna Replication
Stem Cells
Organoids
Toxicology
Environmental Pollution
Cell Biology
Genetics
Molecular Biology
Cancer Research
Areas of Focus
- Genomic Stability Regulation
- Stem Cell Organoid Technology
- Environmental Pollution Toxicology
Work Experience
- 2020-09~Present - Kunming Institute of Zoology, Chinese Academy of Sciences - Researcher
- 2017-06~2020-07 - Wistar Institute (Philadelphia, USA) - Postdoctoral Researcher
- 2016-01~2017-05 - Kunming Institute of Zoology, Chinese Academy of Sciences - Associate Researcher
- 2013-07~2015-12 - Kunming Institute of Zoology, Chinese Academy of Sciences - Assistant Researcher
Academic Background & Achievements
- 2007-09--2013-06 PhD in Science: University of Chinese Academy of Sciences
- 2003-09--2007-06 Bachelor's Degree: Yantai University
Publications
- Lnc956 -TRIM28-HSP90B1 complex on replication forks promotes CMG helicase retention to ensure stem cell genomic stability and embryogenesis, 11th Author, 2023
- TXNRD1 drives innate immune response in senescent cells to promote tumor immune surveillance and age-associated inflammation, 2nd Author, 2023
- Purification of Long Non-coding RNAs on Replication Forks Using iROND (Isolate RNAs on Nascent DNA), 11th Author, 2023
- EPAS1 prevents telomeric damage-induced senescence by enhancing transcription of TRF1,TRF2,and RAD50, 11th Author, 2023
- RETSAT associates with DDX39B to promote fork restarting and resistance to gemcitabine based chemotherapy in pancreatic ductal adenocarcinoma, 11th Author, 2022
- Sensitization of ovarian tumor to immune checkpoint blockade by boosting senescence-associated secretory phenotype, 2nd Author, 2021
- EZH2 Inhibition Sensitizes CARM1-High, Homologous Recombination Proficient Ovarian Cancers to PARP Inhibition, 3rd Author, 2020
- Genome integrity and neurogenesis of postnatal hippocampal neural stem/progenitor cells require a unique regulator Filia, 4th Author, 2020
- Topoisomerase 1 cleavage complex enables pattern recognition and inflammation during senescence, 1st Author, 2020
- KHDC3L mutation causes recurrent pregnancy loss by inducing genomic instability of human early embryonic cells, 4th Author, 2019
- ARID1A promotes genomic stability through protecting telomere cohesion, 1st Author, 2019
- In vitro culture of cynomolgus monkey embryos beyond early gastrulation, 10th Author, 2019
- mouseembryonicstemcellshaveincreasedcapacityforreplicationforkrestartdrivenbythespecificfiliaflopedproteincomplex, 1st Author, 2018
- BET Bromodomain Inhibition Synergizes with PARP Inhibitor in Epithelial Ovarian Cancer, 4th Author, 2017
- Filia Is an ESC-Specific Regulator of DNA Damage Response and Safeguards Genomic Stability, 1st Author, 2015
- Multiple coagulation factor deficiency protein 2 contains the ability to support stem cell self-renewal, 2nd Author, 2013
- In vitro generation of myofibroblasts-like cells from liver epithelial progenitor cells of rhesus monkey (Macaca mulatta), 7th Author, 2011
Awards
- International Society for Stem Cell Research Annual Meeting Travel Award (2016): First Prize
- Yunnan Provincial Research Institute Federation Excellent Paper Award (2016): First Prize
- International Society for Stem Cell Research Annual Meeting Travel Award (2015): First Prize
