Professor | Bo Zhao | Asia Growth Partners

	Upload Avatar (500 x 500)
Name	Bo Zhao
Contact Information	zhaobo@mail.kiz.ac.cn
Language ability	Chinese, English
Province	Yunnan

Upload Avatar (500 x 500)

Name

Bo Zhao

Contact Information

zhaobo@mail.kiz.ac.cn

Language ability

Chinese, English

Province

Yunnan

University/Lab Affiliation and Title	University of Chinese Academy of Sciences
Faculty	Life Sciences
Academic Background & Achievements	2007-09--2013-06 PhD in Science: University of Chinese Academy of Sciences 2003-09--2007-06 Bachelor's Degree: Yantai University
Work Experience	2020-09~Present - Kunming Institute of Zoology, Chinese Academy of Sciences - Researcher 2017-06~2020-07 - Wistar Institute (Philadelphia, USA) - Postdoctoral Researcher 2016-01~2017-05 - Kunming Institute of Zoology, Chinese Academy of Sciences - Associate Researcher 2013-07~2015-12 - Kunming Institute of Zoology, Chinese Academy of Sciences - Assistant Researcher
Awards	International Society for Stem Cell Research Annual Meeting Travel Award (2016): First Prize Yunnan Provincial Research Institute Federation Excellent Paper Award (2016): First Prize International Society for Stem Cell Research Annual Meeting Travel Award (2015): First Prize

University/Lab Affiliation and Title

University of Chinese Academy of Sciences

Faculty

Life Sciences

Academic Background & Achievements

2007-09--2013-06 PhD in Science: University of Chinese Academy of Sciences
2003-09--2007-06 Bachelor's Degree: Yantai University

Work Experience

2020-09~Present - Kunming Institute of Zoology, Chinese Academy of Sciences - Researcher
2017-06~2020-07 - Wistar Institute (Philadelphia, USA) - Postdoctoral Researcher
2016-01~2017-05 - Kunming Institute of Zoology, Chinese Academy of Sciences - Associate Researcher
2013-07~2015-12 - Kunming Institute of Zoology, Chinese Academy of Sciences - Assistant Researcher

Awards

International Society for Stem Cell Research Annual Meeting Travel Award (2016): First Prize
Yunnan Provincial Research Institute Federation Excellent Paper Award (2016): First Prize
International Society for Stem Cell Research Annual Meeting Travel Award (2015): First Prize

Areas of Focus	Genomic Stability Regulation Stem Cell Organoid Technology Environmental Pollution Toxicology
Publications	Lnc956 -TRIM28-HSP90B1 complex on replication forks promotes CMG helicase retention to ensure stem cell genomic stability and embryogenesis, 11th Author, 2023 TXNRD1 drives innate immune response in senescent cells to promote tumor immune surveillance and age-associated inflammation, 2nd Author, 2023 Purification of Long Non-coding RNAs on Replication Forks Using iROND (Isolate RNAs on Nascent DNA), 11th Author, 2023 EPAS1 prevents telomeric damage-induced senescence by enhancing transcription of TRF1,TRF2,and RAD50, 11th Author, 2023 RETSAT associates with DDX39B to promote fork restarting and resistance to gemcitabine based chemotherapy in pancreatic ductal adenocarcinoma, 11th Author, 2022 Sensitization of ovarian tumor to immune checkpoint blockade by boosting senescence-associated secretory phenotype, 2nd Author, 2021 EZH2 Inhibition Sensitizes CARM1-High, Homologous Recombination Proficient Ovarian Cancers to PARP Inhibition, 3rd Author, 2020 Genome integrity and neurogenesis of postnatal hippocampal neural stem/progenitor cells require a unique regulator Filia, 4th Author, 2020 Topoisomerase 1 cleavage complex enables pattern recognition and inflammation during senescence, 1st Author, 2020 KHDC3L mutation causes recurrent pregnancy loss by inducing genomic instability of human early embryonic cells, 4th Author, 2019 ARID1A promotes genomic stability through protecting telomere cohesion, 1st Author, 2019 In vitro culture of cynomolgus monkey embryos beyond early gastrulation, 10th Author, 2019 mouseembryonicstemcellshaveincreasedcapacityforreplicationforkrestartdrivenbythespecificfiliaflopedproteincomplex, 1st Author, 2018 BET Bromodomain Inhibition Synergizes with PARP Inhibitor in Epithelial Ovarian Cancer, 4th Author, 2017 Filia Is an ESC-Specific Regulator of DNA Damage Response and Safeguards Genomic Stability, 1st Author, 2015 Multiple coagulation factor deficiency protein 2 contains the ability to support stem cell self-renewal, 2nd Author, 2013 In vitro generation of myofibroblasts-like cells from liver epithelial progenitor cells of rhesus monkey (Macaca mulatta), 7th Author, 2011

Areas of Focus

Genomic Stability Regulation
Stem Cell Organoid Technology
Environmental Pollution Toxicology

Publications

Lnc956 -TRIM28-HSP90B1 complex on replication forks promotes CMG helicase retention to ensure stem cell genomic stability and embryogenesis, 11th Author, 2023
TXNRD1 drives innate immune response in senescent cells to promote tumor immune surveillance and age-associated inflammation, 2nd Author, 2023
Purification of Long Non-coding RNAs on Replication Forks Using iROND (Isolate RNAs on Nascent DNA), 11th Author, 2023
EPAS1 prevents telomeric damage-induced senescence by enhancing transcription of TRF1,TRF2,and RAD50, 11th Author, 2023
RETSAT associates with DDX39B to promote fork restarting and resistance to gemcitabine based chemotherapy in pancreatic ductal adenocarcinoma, 11th Author, 2022
Sensitization of ovarian tumor to immune checkpoint blockade by boosting senescence-associated secretory phenotype, 2nd Author, 2021
EZH2 Inhibition Sensitizes CARM1-High, Homologous Recombination Proficient Ovarian Cancers to PARP Inhibition, 3rd Author, 2020
Genome integrity and neurogenesis of postnatal hippocampal neural stem/progenitor cells require a unique regulator Filia, 4th Author, 2020
Topoisomerase 1 cleavage complex enables pattern recognition and inflammation during senescence, 1st Author, 2020
KHDC3L mutation causes recurrent pregnancy loss by inducing genomic instability of human early embryonic cells, 4th Author, 2019
ARID1A promotes genomic stability through protecting telomere cohesion, 1st Author, 2019
In vitro culture of cynomolgus monkey embryos beyond early gastrulation, 10th Author, 2019
mouseembryonicstemcellshaveincreasedcapacityforreplicationforkrestartdrivenbythespecificfiliaflopedproteincomplex, 1st Author, 2018
BET Bromodomain Inhibition Synergizes with PARP Inhibitor in Epithelial Ovarian Cancer, 4th Author, 2017
Filia Is an ESC-Specific Regulator of DNA Damage Response and Safeguards Genomic Stability, 1st Author, 2015
Multiple coagulation factor deficiency protein 2 contains the ability to support stem cell self-renewal, 2nd Author, 2013
In vitro generation of myofibroblasts-like cells from liver epithelial progenitor cells of rhesus monkey (Macaca mulatta), 7th Author, 2011

Genomic Stability Dna Replication Stem Cells Organoids Toxicology Environmental Pollution Cell Biology Genetics Molecular Biology Cancer Research

Yanfang Wang - Tongji University

Jingping Hu - Central South University

Wen Doudou - Central South University

View All

Personal Information

Academic Information

Research

Contact us

No account yet?

Personal Information

Academic Information

Research

Contact us